PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf01775g02020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 147aa    MW: 16763.1 Da    PI: 9.1395
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf01775g02020.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF46.74.2e-151659245
                              ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
                    SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                              +ie k   + tfskRr  + KKA+EL +LC+++v +ii s+tg+
  Peinf101Scf01775g02020.1 16 KIEKKDSLYATFSKRRSSLYKKANELITLCNVDVGIIISSPTGN 59
                              6888888999********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.5E-19766IPR002100Transcription factor, MADS-box
PROSITE profilePS5006619.596767IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.32E-23885IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-12929IPR002100Transcription factor, MADS-box
PfamPF003191.8E-191663IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-122944IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-124465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MVSKITQGRK KIPMAKIEKK DSLYATFSKR RSSLYKKANE LITLCNVDVG IIISSPTGNP  60
FSFFHPTVDS VIDRFQNPNM LSESTRLVAV HAQNRVNQLN SRLEEFDTRE DVASAQTLLI  120
NQLMGSRQKG WWESIEQFNE EEATIIV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016488243.18e-68PREDICTED: agamous-like MADS-box protein AGL29
TrEMBLM1DVS14e-56M1DVS1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000951901e-55(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38220138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.18e-27AGAMOUS-like 61